Dendra2 E. coli Recombinant Protein

Price:250 μg￥1,160.00 ;

SKU: PME49281 Category: ECD Proteins

Target	Dendra2 E. coli Recombinant Protein
Synonyms	N/A
Description	Purified fluorescent protein Dendra2 (photoswitchable), with N-terminal HIS tag, expressed in E. coli, 250ug
Delivery	1 week
Uniprot ID	N/A
Expression Host	E. coli
Tag	N-His
Molecular Characterization	N/A
Molecular Weight	27.5 kDa
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Formulation & Reconstitution	PBS, pH7.4, 10% glycerol.
Storage & Shipping	Store at -80°C.
Background	MRGSGSMNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVWSGDSGVYK
Usage	Research use only
Conjugate	Unconjugated